Recombinant Full Length Schizosaccharomyces Pombe Erad-Associated E3 Ubiquitin-Protein Ligase Hrd1(Hrd1) Protein, His-Tagged
Cat.No. : | RFL27211SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe ERAD-associated E3 ubiquitin-protein ligase hrd1(hrd1) Protein (O74757) (1-677aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-677) |
Form : | Lyophilized powder |
AA Sequence : | MKFILYVLASLVLFGLSVLLSLYSSANVYSATVMISQSPVHITIGLNVCLCLFFAIANAL KTLLFGSLQTFELELLYEQFWITLTEIMLAITVFREAISISFFMLLSTLMFARVFHSICS FRTERLQIQLTDQRFHIFSRLTCAYFVLSILDASLIYLCFTSEHLGDKSTRMLFVCEFSV LLLNLTIEASKLCIYLYEARHLDQVWDEKSTYLFRLEVCRDGLRLLAYSLLFMYQFPYVS VPIYSIRQMYTCFYSLFRRIREHARFRQATRDMNAMYPTATEEQLTNSDRTCTICREEMF HPDHPPENTDEMEPLPRGLDMTPKRLPCGHILHFHCLRNWLERQQTCPICRRSVIGNQSS PTGIPASPNVRATQIATQVPNPQNTPTTTAVPGITNSSNQGDPQASTFNGVPNANSSGFA AHTQDLSSVIPRRIALRDGWTMLPIPGTRRIPTYSQSTSTTNPSATPTTGDPSNSTYGGP QTFPNSGNNPNFNRGIAGIVPPGWRLVSSNTQSLSTNSAMTSLYQNASSADNNLGSSLPN VVPLSRGLTQSNETSNTFPAASSNISSQLRELHTKIDELRETVSNFRADYNSIRTSLNQL EAASGINERIQTTSADSLLNSNGMSGTEGFENTQTSITTNDNQSSILTSSDQTSPFATDE DRQNSRNVQLETVDENF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hrd1 |
Synonyms | hrd1; SPBC17D11.02c; ERAD-associated E3 ubiquitin-protein ligase hrd1; RING-type E3 ubiquitin transferase hrd1 |
UniProt ID | O74757 |
◆ Recombinant Proteins | ||
Mdk-567M | Recombinant Mouse Mdk protein | +Inquiry |
IK-3019R | Recombinant Rat IK Protein | +Inquiry |
RFL24509CF | Recombinant Full Length Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
SWI5-5511R | Recombinant Rat SWI5 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP19-1-1554H | Recombinant Human KRTAP19-1 | +Inquiry |
◆ Native Proteins | ||
C. albicans-38 | Native Candida albicans Antigen | +Inquiry |
TF-132B | Native Bovine Transferrin | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
COL2A1-13B | Native Bovine COL2A1 Protein | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF1-1004RCL | Recombinant Rat SLAMF1 cell lysate | +Inquiry |
ITFG2-5139HCL | Recombinant Human ITFG2 293 Cell Lysate | +Inquiry |
CARD11-7850HCL | Recombinant Human CARD11 293 Cell Lysate | +Inquiry |
KLRK1-001HCL | Recombinant Human KLRK1 cell lysate | +Inquiry |
C11orf24-74HCL | Recombinant Human C11orf24 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hrd1 Products
Required fields are marked with *
My Review for All hrd1 Products
Required fields are marked with *
0
Inquiry Basket