Recombinant Full Length Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged
Cat.No. : | RFL24509CF |
Product Overview : | Recombinant Full Length Photosystem II reaction center protein H(psbH) Protein (P48105) (1-67aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cyanophora paradoxa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-67) |
Form : | Lyophilized powder |
AA Sequence : | MPQRTALGNILRPLNSEYGKVAPGWGTTPLMAVFMLLFFVFLLIIIQIYNSSLLLENVQV SWTAATA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbH |
Synonyms | psbH; Photosystem II reaction center protein H; PSII-H |
UniProt ID | P48105 |
◆ Recombinant Proteins | ||
POLE3-4224R | Recombinant Rat POLE3 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXJ1B-1933Z | Recombinant Zebrafish FOXJ1B | +Inquiry |
FHOD1-5880M | Recombinant Mouse FHOD1 Protein | +Inquiry |
CDC25B-6535Z | Recombinant Zebrafish CDC25B | +Inquiry |
PET117-3374R | Recombinant Rhesus monkey PET117 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
Uricase-089P | Active Native Porcine Uricase Protein | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
Apotransferrin-36M | Native Mouse Apotransferrin | +Inquiry |
toxB-11C | Native C. difficile toxB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDADC1-7672HCL | Recombinant Human CDADC1 293 Cell Lysate | +Inquiry |
ASPSCR1-139HCL | Recombinant Human ASPSCR1 cell lysate | +Inquiry |
Spleen-473C | Cynomolgus monkey Spleen Membrane Lysate | +Inquiry |
PTPN6-001MCL | Recombinant Mouse PTPN6 cell lysate | +Inquiry |
ZNF624-2066HCL | Recombinant Human ZNF624 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All psbH Products
Required fields are marked with *
My Review for All psbH Products
Required fields are marked with *
0
Inquiry Basket