Recombinant Full Length Schizosaccharomyces Pombe Alpha-1,3/1,6-Mannosyltransferase Alg2(Alg2) Protein, His-Tagged
Cat.No. : | RFL25299SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Alpha-1,3/1,6-mannosyltransferase alg2(alg2) Protein (Q96WW6) (1-511aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-511) |
Form : | Lyophilized powder |
AA Sequence : | MSQENSVHRSSTKKTPIKIAFIHPDLGIGGAERLVVDAAVGLQSLGKEVVVFTSHCDKKH CFEEIRDGTIKVKVYGDWLPSSIFGRLSIFCSSLRQVYLTMILLTNYMHFDAIIVDQLST CVPFLLLASQMILFYCHFPDKYLAKRGGILKKLYRIPFDTVEAESVRLADRIVVNSKFTA SVFKKAFPKIRKPLRIVHPCVDIEAASKPLEFQLPEKILYLRYSQRKLLISVNRFERKKD IRLAIDAFSALRDLSANRFPEYLLLVAGGYDIRVSENRRYLKELQEFCEQKDLSYTTVKD NWDNITVAPSTNVLFLLSVPSKVRDALISSSRILLYTPENEHFGIVPLEAMLRKVPVLAQ TNGGPLETVIDGKNGWLRPRDAKIWGNVIYEATTSTTYDTAAMGEAGSEWVKNEFSTDAM ARKFESEIMSGIRSITPEKRLMRRVNGLLAVFVLFMLFWGTCIIAATVPFAIIKLYFAQT YSSVKLGFMLGTCIVSVSFLTFTVYAKLTNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alg2 |
Synonyms | alg2; pi010; SPBC11B10.01; SPBC32H8.14; Alpha-1,3/1,6-mannosyltransferase alg2; Asparagine-linked glycosylation protein 2; GDP-Man:Man(1GlcNAc(2-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1GlcNAc(2-PP-dolichol mannosyltransferase; GDP-Man:Man(2GlcN |
UniProt ID | Q96WW6 |
◆ Recombinant Proteins | ||
RFL29126HF | Recombinant Full Length Human Alpha-1,3/1,6-Mannosyltransferase Alg2(Alg2) Protein, His-Tagged | +Inquiry |
ALG2-5978Z | Recombinant Zebrafish ALG2 | +Inquiry |
ALG2-463H | Recombinant Human ALG2 Protein, GST-tagged | +Inquiry |
RFL1068YF | Recombinant Full Length Yarrowia Lipolytica Alpha-1,3/1,6-Mannosyltransferase Alg2(Alg2) Protein, His-Tagged | +Inquiry |
ALG2-1546M | Recombinant Mouse ALG2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALG2-8906HCL | Recombinant Human ALG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alg2 Products
Required fields are marked with *
My Review for All alg2 Products
Required fields are marked with *
0
Inquiry Basket