Recombinant Human ALG2 Protein, GST-tagged
Cat.No. : | ALG2-463H |
Product Overview : | Human ALG2 full-length ORF ( NP_149078.1, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the glycosyltransferase 1 family. The encoded protein acts as an alpha 1,3 mannosyltransferase, mannosylating Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. Defects in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ii). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
Molecular Mass : | 73.5 kDa |
AA Sequence : | MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCFAESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSACIPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFTAAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGFLCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALG2 asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ALG2 |
Synonyms | ALG2; asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 2 homolog (yeast, alpha 1,3 mannosyltransferase); alpha-1,3/1,6-mannosyltransferase ALG2; CDGIi; FLJ14511; hALPG2; NET38; homolog of yeast ALG2; alpha-1,3-mannosyltransferase ALG2; asparagine-linked glycosylation protein 2 homolog; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); |
Gene ID | 85365 |
mRNA Refseq | NM_033087 |
Protein Refseq | NP_149078 |
MIM | 607905 |
UniProt ID | Q9H553 |
◆ Cell & Tissue Lysates | ||
ALG2-8906HCL | Recombinant Human ALG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALG2 Products
Required fields are marked with *
My Review for All ALG2 Products
Required fields are marked with *
0
Inquiry Basket