Recombinant Full Length Schistocerca Americana Innexin Inx2(Inx2) Protein, His-Tagged
Cat.No. : | RFL32541SF |
Product Overview : | Recombinant Full Length Schistocerca americana Innexin inx2(inx2) Protein (Q9XYN1) (1-359aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schistocerca americana (American grasshopper) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-359) |
Form : | Lyophilized powder |
AA Sequence : | MFDVFGSVKGLLKLDSVCIDNNLFRLHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LAVMDTYCWIYSTFTIPNRLNGKIGLEVAHPGVGAHVAGKDEVKYHKYYQWVCFVLFFQA ILFYIPRYLWKTWEGGRIKMLVLDLNSPVVNEQSKADRKKLLVDYFATNLHTQNFYAYRF FICEALNFVNVVGQIYFMDLFLDGEFTTYGSDVVRFTEMEPEERSDPMSRVFPKVTKCTF HKYGPSGSVQTFDGLCVLPLNIVNEKIYVFLWFWFVILSVLTGIGLVYRLATAMGPQMRM YLLRARSRLAPQDQIETISNKCQIGDWFVLYQLGKNIDPLIYKELVADLAKKLEGKEIV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | inx2 |
Synonyms | inx2; Innexin inx2; Innexin-2; G-Inx2 |
UniProt ID | Q9XYN1 |
◆ Recombinant Proteins | ||
RFL19001DF | Recombinant Full Length Drosophila Virilis Protein Brown(Bw) Protein, His-Tagged | +Inquiry |
NANOG-3605H | Recombinant Human NANOG Protein, His/GST-tagged | +Inquiry |
DEFB4A-3752HF | Recombinant Full Length Human DEFB4A Protein, GST-tagged | +Inquiry |
C4orf3-129H | Recombinant Human C4orf3 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CACNG6-0278H | Recombinant Human CACNG6 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-60H | Native Human Prothrombin Frag 2 | +Inquiry |
IGHA-209H | Native Human Immunoglobulin A (IgA) | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
VTN-385P | Native Pig Vitronectin | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESRRA-576HCL | Recombinant Human ESRRA cell lysate | +Inquiry |
TTLL6-666HCL | Recombinant Human TTLL6 293 Cell Lysate | +Inquiry |
STAG1-1430HCL | Recombinant Human STAG1 293 Cell Lysate | +Inquiry |
FBXL14-271HCL | Recombinant Human FBXL14 lysate | +Inquiry |
POU2F3-3002HCL | Recombinant Human POU2F3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All inx2 Products
Required fields are marked with *
My Review for All inx2 Products
Required fields are marked with *
0
Inquiry Basket