Recombinant Full Length Drosophila Virilis Protein Brown(Bw) Protein, His-Tagged
Cat.No. : | RFL19001DF |
Product Overview : | Recombinant Full Length Drosophila virilis Protein brown(bw) Protein (Q24739) (1-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila virilis (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-668) |
Form : | Lyophilized powder |
AA Sequence : | MPMDEGDAQGSLLLEWKQLNYYVPAQEQSNYSFWNECRKQRELGILHDVSGHLKTGDLIA ILGGSGAGKTTLLAAISQRLRGNLTGDVVLNGMAMERDQMTRISSFLREFEINVKTFTAY DDLYFMSHFKMHRRTTKSEKRQAVSDLLLAVGLRDAAHTRIQQLSGGERKRLSLAEELIT DPIFLFCDEPTTGLDSFSAYTVIKTLRHLCTRRRIAKHSLTQVYGEDSFATPSDNGSSGS NSIEMEIVDNSHESLLQAMKELPTLGVLNNSPNGTQKKAAICSIHQPTSDIFELFTHIIL MDGGRIVYQGRTEQAAKFFTEGFMQPKNCNPADFYLKTLADGQGSKNAGELLRAKYEHET DGLYSGSWLLARNYSGDYMKHVQNFKKIRWIYQVYLLVIRFMTEDLANIRSGLIGFGFFM TTAVTLSLMYSGVGGLTQRTVQDVGGSIFMLSNEMIFTFSYGVTYIFPAALPIIRREVAE GTYSLSAYYVALVLSFVPVAFFKGYMFLSVIYASIYYTRGFLLYITMGFLMSLSAIAAVG YGVFLSSLFETDKMASECAAPFDLIFLIFGGTYMNVDSVPLLKYFSLFFYSNEALMYNFW IDIDNIACXVNDEHPCCQTGLEVLQQASFRTADYTFWLDCASLLVVALVFHIVSFTLIRR YINRSGYY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bw |
Synonyms | bw; Protein brown |
UniProt ID | Q24739 |
◆ Recombinant Proteins | ||
PRRG4-4289C | Recombinant Chicken PRRG4 | +Inquiry |
RGS14-1007H | Recombinant Human RGS14 Protein (P2-L566), Tag Free | +Inquiry |
Pcolce-4717M | Recombinant Mouse Pcolce Protein, Myc/DDK-tagged | +Inquiry |
DVL2-1844H | Recombinant Human DVL2 protein, His-tagged | +Inquiry |
EGF-5993H | Recombinant Human EGF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-61H | Native Human Collagen Type I/III | +Inquiry |
Fibrinogen-7589H | Native Human Fibrinogen | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
COL5-136H | Native Human Collagen Type IV | +Inquiry |
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC35E2-1731HCL | Recombinant Human SLC35E2 293 Cell Lysate | +Inquiry |
TMSL3-902HCL | Recombinant Human TMSL3 293 Cell Lysate | +Inquiry |
PCDHGA12-1303HCL | Recombinant Human PCDHGA12 cell lysate | +Inquiry |
VPS35-389HCL | Recombinant Human VPS35 293 Cell Lysate | +Inquiry |
ANKRD5-81HCL | Recombinant Human ANKRD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bw Products
Required fields are marked with *
My Review for All bw Products
Required fields are marked with *
0
Inquiry Basket