Recombinant Full Length Salmonella Typhimurium Uncharacterized Protein Yfhr(Yfhr) Protein, His-Tagged
Cat.No. : | RFL34628SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Uncharacterized protein yfhR(yfhR) Protein (Q8ZN39) (1-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-292) |
Form : | Lyophilized powder |
AA Sequence : | MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAESITFTAKDGT HLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSWLPERNVNLFMFDYRGFGESE GTPSQEGLLDDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVLAAVGHCVGCANMRYADQ AGIRAIILDSTFLSYSSIANQMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIP WQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAMIKFIQTALSAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfhR |
Synonyms | yfhR; STM2547; Uncharacterized protein YfhR |
UniProt ID | Q8ZN39 |
◆ Recombinant Proteins | ||
BPI-7374H | Recombinant Human BPI protein, His-tagged | +Inquiry |
CST3-373M | Recombinant Mouse CST3 Protein, His-tagged | +Inquiry |
FUNDC1-2662H | Recombinant Human FUNDC1 Protein, His-tagged | +Inquiry |
EPAS1-29318TH | Recombinant Human EPAS1 | +Inquiry |
HA-4293I | Recombinant Influenza A virus HA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
IgG-342R | Native RABBIT IgG | +Inquiry |
F2R-27H | Native Human F2R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4B2-859RCL | Recombinant Rat CLEC4B2 cell lysate | +Inquiry |
AMOT-8878HCL | Recombinant Human AMOT 293 Cell Lysate | +Inquiry |
ICAM2-2427HCL | Recombinant Human ICAM2 cell lysate | +Inquiry |
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
ACVRL1-994CCL | Recombinant Canine ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfhR Products
Required fields are marked with *
My Review for All yfhR Products
Required fields are marked with *
0
Inquiry Basket