Recombinant Human EPAS1

• Cat.No.: EPAS1-29318TH
• Product Overview: Recombinant fragment (amino acids 28-347) of Human HIF2 alpha with proprietary tag at the N terminal; Predicted MW 60.83 kDa, inclusive of tag.

Specification

• Description: This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4.
• Protein length: 320 amino acids
• Molecular Weight: 60.830kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTH KLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGD MIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENL SLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKS ATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCE PIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGY HPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQY RMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEI
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.
• Tag: Non

Gene Information

• Gene Name: EPAS1 endothelial PAS domain protein 1 [ Homo sapiens ]
• Official Symbol: EPAS1
• Synonyms: EPAS1; endothelial PAS domain protein 1; endothelial PAS domain-containing protein 1; bHLHe73; HIF 1 alpha like factor; HIF2A; HLF; MOP2; PASD2
• Gene ID: 2034
• mRNA Refseq: NM_001430
• Protein Refseq: NP_001421
• MIM: 603349
• Uniprot ID: Q99814
• Chromosome Location: 2p21-p16
• Pathway: Adipogenesis, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem
• Function: DNA binding; histone acetyltransferase binding; protein binding; protein heterodimerization activity; contributes_to sequence-specific DNA binding