Recombinant Full Length Salmonella Typhimurium Sensor Protein Zras(Zras) Protein, His-Tagged
Cat.No. : | RFL7804SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Sensor protein ZraS(zraS) Protein (P37461) (1-465aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-465) |
Form : | Lyophilized powder |
AA Sequence : | MSFIRLHKDAAATWLSRLLPAAIFILVGLFSIMVIRDYGRESAAARQTLLEKGNVLIRAL ESGTRVGMGMRMHHAQQQTLLEEMAGQPGVLWFAVTDAQGVIITHSNPGMVGKSLYSPSE MHQLNPGPQERWRRVDVAANGETVPALEIYRQFQPLFGMRGHGMRGHGMARSANDDEPAK QTIFIAFDASELAATQAREWRNTLIVLSALAAVLLATLLAFFWHQRYQRSHRELLDAMKR KEKLVAMGHLAAGVAHEIRNPLSSIKGLAKYFAERTPAGGESHELAQVMAKEADRLNRVV SELLELVKPAHLTLQTVNLNDIITHSLNLVSQDAQSREIQLRFTANETLKRIQADPDRLT QVLLNLYLNAIHAIGRQGTISVEAKESGTDRVIITVTDSGKGIAPDQLEAIFTPYFTTKA DGTGLGLAVVQNIIEQHGGAIKVKSIEGKGAVFTIWLPVIARQQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zraS |
Synonyms | zraS; hydH; STM4173; STMF1.26; Sensor protein ZraS |
UniProt ID | P37461 |
◆ Native Proteins | ||
F2-1882H | Native Human Coagulation Factor II | +Inquiry |
GOT1-5353P | Active Native Porcine GOT1 protein | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
RXFP2-2099HCL | Recombinant Human RXFP2 293 Cell Lysate | +Inquiry |
EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Fetal Diencephalon-138H | Human Fetal Diencephalon Lysate | +Inquiry |
P2RY2-3486HCL | Recombinant Human P2RY2 293 Cell Lysate | +Inquiry |
NSFL1C-3687HCL | Recombinant Human NSFL1C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zraS Products
Required fields are marked with *
My Review for All zraS Products
Required fields are marked with *
0
Inquiry Basket