Recombinant Full Length Salmonella Typhimurium L-Alanine Exporter Alae(Alae) Protein, His-Tagged
Cat.No. : | RFL7152SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium L-alanine exporter AlaE(alaE) Protein (Q8ZML6) (1-149aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-149) |
Form : | Lyophilized powder |
AA Sequence : | MFSPQSRLRHAVADTFAMVVYCSVVNMLIEIFLSGMSFEQSLSSRLVAIPVNILIAWPYG VYRDLIMRVARKASPAGWAKNLADVLAYVTFQSPVYIIILLTVGAGWHQIVAAVSSNIVV SMLMGAVYGYFLDYCRRLFKVSSYHQAKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alaE |
Synonyms | alaE; STM2800; L-alanine exporter AlaE |
UniProt ID | Q8ZML6 |
◆ Native Proteins | ||
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Ferritin-181R | Native Rat Ferritin | +Inquiry |
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
AGT-152H | Native Human Angiotensinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFKM-3271HCL | Recombinant Human PFKM 293 Cell Lysate | +Inquiry |
Tonsilla Cerebelli-539H | Human Tonsilla Cerebelli Membrane Lysate | +Inquiry |
DPY19L3-234HCL | Recombinant Human DPY19L3 lysate | +Inquiry |
Heart-212R | Rabbit Heart Lysate | +Inquiry |
Fetal Small Intestine-164H | Human Fetal Small Intestine Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alaE Products
Required fields are marked with *
My Review for All alaE Products
Required fields are marked with *
0
Inquiry Basket