Recombinant Full Length Salmonella Typhimurium Cation-Efflux Pump Fief(Fief) Protein, His-Tagged
Cat.No. : | RFL9208SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Cation-efflux pump FieF(fieF) Protein (Q8ZKR4) (1-300aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-300) |
Form : | Lyophilized powder |
AA Sequence : | MNQTYGRLVSRAAIAATAMASALLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVV RYSLQPADDEHTFGHGKAESLAALAQSMFISGSALFLFLTSIQNLIKPTPMNDPGVGIGV TVIALICTIILVTFQRWVVRKTQSQAVRADMLHYQSDVMMNGAILIALGLSWYGWHRADA LFALGIGIYILYSALRMGYEAVQSLLDRALPDAERQEIIDIVTSWPGVSGAHDLRTRQSG PTRFIQIHLEMEDNLPLVQAHFVADQVEQAILQRFPGSDVIIHQDPCSVVPREGRKFELV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fieF |
Synonyms | fieF; STM4061; Cation-efflux pump FieF |
UniProt ID | Q8ZKR4 |
◆ Recombinant Proteins | ||
INPP5A-5108H | Recombinant Human INPP5A Protein, GST-tagged | +Inquiry |
SLC30A5-8321M | Recombinant Mouse SLC30A5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RIN2-1040H | Recombinant Human RIN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF134-301130H | Recombinant Human ZNF134 protein, GST-tagged | +Inquiry |
ATP1B2-15901H | Recombinant Human ATP1B2, His-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
ADA-P036B | Native Bovine adenosine deaminase therapeutic protein (Pegademase bovine) | +Inquiry |
Lung-017H | Human Lung Lysate, Total Protein | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ORMDL3-3546HCL | Recombinant Human ORMDL3 293 Cell Lysate | +Inquiry |
PSMB10-512HCL | Recombinant Human PSMB10 lysate | +Inquiry |
Thymus-678H | Hamster Thymus Lysate, Total Protein | +Inquiry |
MUSTN1-4055HCL | Recombinant Human MUSTN1 293 Cell Lysate | +Inquiry |
MLKL-1115HCL | Recombinant Human MLKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All fieF Products
Required fields are marked with *
My Review for All fieF Products
Required fields are marked with *
0
Inquiry Basket