Recombinant Human ZNF134 protein, GST-tagged
Cat.No. : | ZNF134-301130H |
Product Overview : | Recombinant Human ZNF134 (96-179 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Tyr96-Ser179 |
AA Sequence : | YQKCYSIEQPLRRDKSEASIVRNCTVSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ZNF134 zinc finger protein 134 [ Homo sapiens ] |
Official Symbol | ZNF134 |
Synonyms | ZNF134; zinc finger protein 134; zinc finger protein 134 (clone pHZ 15); pHZ 15; zinc finger protein 134 (clone pHZ-15); pHZ-15; MGC138499; MGC141970; |
Gene ID | 7693 |
mRNA Refseq | NM_003435 |
Protein Refseq | NP_003426 |
MIM | 604076 |
UniProt ID | P52741 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ZNF134 Products
Required fields are marked with *
My Review for All ZNF134 Products
Required fields are marked with *
0
Inquiry Basket