Recombinant Full Length Salmonella Typhi Phosphoglycerate Transport Regulatory Protein Pgtc(Pgtc) Protein, His-Tagged
Cat.No. : | RFL22929SF |
Product Overview : | Recombinant Full Length Salmonella typhi Phosphoglycerate transport regulatory protein pgtC(pgtC) Protein (P0A234) (25-397aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-397) |
Form : | Lyophilized powder |
AA Sequence : | WIIQRWQTEPGSVMIRTLNRTSGSLEQLLDTANAENVDLILTSSPMLLQHLQEHQKLALL DSAPAASQKLVPRSIRSTSVAVAVSGFGLLINRSALAARHLPPPADWQDMGLPSYQGALL MSSPSRSDTNHLMVESLLQQKGWTAGWATLLAISGNLVTISSRSFGVADKIKSGLGVAGP VIDNYANLLLNDPNLAFTYFPYSAVSPTYVAVLKNSRHADEARAFIHYLLSPKGQRILAD ANTGKYPVAPLSADNPRAAQQQRLMAQPPLNYRLILKRQQLVQRMFDTAISFRLAQLKDA WRALHSAETRLKRPLPEIRALLTSVPVDAASSEDETWLAQFDNKSFAEQKMMEWQIWFLN NQRLAIHKLEELK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pgtC |
Synonyms | pgtC; STY2635; t0460; Phosphoglycerate transport regulatory protein PgtC |
UniProt ID | P0A234 |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
SUMO Protease-01 | Native purified SUMO Protease, N-His-tagged | +Inquiry |
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
Lectin-1794A | Active Native Artocarpus integrifolia Jacalin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS53-1916HCL | Recombinant Human VPS53 cell lysate | +Inquiry |
COX7B2-7324HCL | Recombinant Human COX7B2 293 Cell Lysate | +Inquiry |
LYPD2-4591HCL | Recombinant Human LYPD2 293 Cell Lysate | +Inquiry |
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
SATB1-2054HCL | Recombinant Human SATB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pgtC Products
Required fields are marked with *
My Review for All pgtC Products
Required fields are marked with *
0
Inquiry Basket