Recombinant Full Length Escherichia Coli O6:K15:H31 Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL12065EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Bifunctional protein aas(aas) Protein (Q0TDZ6) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDTKALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVEMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGTSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERDWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELMRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ECP_2849; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long |
UniProt ID | Q0TDZ6 |
◆ Recombinant Proteins | ||
PDE3B-474H | Recombinant Human PDE3B, GST-tagged, Active | +Inquiry |
Sh2b3-1332M | Recombinant Mouse Sh2b3 Protein, MYC/DDK-tagged | +Inquiry |
UBA52-02H | Enzyme catalysed Human Poly-ubiquitin (n2-7; K63-linked) Protein | +Inquiry |
CSDE1-28019TH | Recombinant Human CSDE1, His-tagged | +Inquiry |
gliadin-1045W | Recombinant Wheat gliadin protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
IgG-017R | Native Rabbit IgG Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
SLC22A6-1793HCL | Recombinant Human SLC22A6 293 Cell Lysate | +Inquiry |
Eye-92M | Mouse Eye Tissue Lysate (14 Days Old) | +Inquiry |
CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry |
Lymph-646B | Bovine Lymph Nodes Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket