Recombinant Full Length Salmonella Gallinarum Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL21445SF |
Product Overview : | Recombinant Full Length Salmonella gallinarum Bifunctional protein aas(aas) Protein (B5RDY6) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella gallinarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFGFFRNLFRVLYRVRVTGDVRALQGNRVLITPNHVSFIDGMLLALFLPVRPVFAVYTS ISQQWYMRWLTPLIDFVPLDPTKPMSIKHLVRLVEQGRAVVIFPEGRISVTGSLMKIYDG AGFVAAKSGATVIPLRIDGAELTPFSRLKGLVKRRLFPRIQLHILPPTQIPMPEAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLAAQYRYGAGKNCIEDINFTPDTYRKLLTK TLFVGRILEKYSVEGEKIGLMLPNAAISAAVIFGAVSRRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTPADKLWIFAHLLAPRLAQV KQQPEDAAIILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTANDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRNCTVLFGTSTFLGNYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLAVPGIENGGRLQLKGPNIMNGYLRVEKPGVLEVPSAENARGETERGWYDTGDIVR FDENGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSADKMHATAIKSDASKGEALVLFT TDSELTREKLQHYAREHGIPELAVPRDIRYLKQLPLLGSGKPDFVTLKSWVDAPEQHHE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; SG2919; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; Long-c |
UniProt ID | B5RDY6 |
◆ Recombinant Proteins | ||
RFL10275PF | Recombinant Full Length Pongo Abelii Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
SDC3-685H | Active Recombinant Human SDC3 Protein, His-tagged | +Inquiry |
UGT5A2-4564Z | Recombinant Zebrafish UGT5A2 | +Inquiry |
Rftn2-5479M | Recombinant Mouse Rftn2 Protein, Myc/DDK-tagged | +Inquiry |
CAPG-1117R | Recombinant Rat CAPG Protein | +Inquiry |
◆ Native Proteins | ||
COL2A1-16C | Native Chicken COL2A1 Protein | +Inquiry |
Lectin-1775E | Active Native Erythrina Cristagalli Lectin Protein | +Inquiry |
VTN-31735TH | Native Human VTN | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Stomach-63H | Human Stomach Tissue Lysate | +Inquiry |
FOXRED2-6140HCL | Recombinant Human FOXRED2 293 Cell Lysate | +Inquiry |
PWWP2B-2654HCL | Recombinant Human PWWP2B 293 Cell Lysate | +Inquiry |
PURG-2664HCL | Recombinant Human PURG 293 Cell Lysate | +Inquiry |
PREX2-466HCL | Recombinant Human PREX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket