Recombinant Full Length Salmonella Dublin Upf0761 Membrane Protein Yihy(Yihy) Protein, His-Tagged
Cat.No. : | RFL4714SF |
Product Overview : | Recombinant Full Length Salmonella dublin UPF0761 membrane protein yihY(yihY) Protein (B5FP16) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella dublin |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yihY |
Synonyms | yihY; SeD_A4416; UPF0761 membrane protein YihY |
UniProt ID | B5FP16 |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
C8-103H | Native Human C8 Protein | +Inquiry |
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3L4-397HCL | Recombinant Human CREB3L4 cell lysate | +Inquiry |
PTPLB-2687HCL | Recombinant Human PTPLB 293 Cell Lysate | +Inquiry |
SLC37A3-1727HCL | Recombinant Human SLC37A3 293 Cell Lysate | +Inquiry |
RGL2-2390HCL | Recombinant Human RGL2 293 Cell Lysate | +Inquiry |
SMPX-1653HCL | Recombinant Human SMPX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yihY Products
Required fields are marked with *
My Review for All yihY Products
Required fields are marked with *
0
Inquiry Basket