Recombinant Full Length Salmonella Typhimurium Upf0761 Membrane Protein Yihy(Yihy) Protein, His-Tagged
Cat.No. : | RFL9403SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium UPF0761 membrane protein yihY(yihY) Protein (Q8ZKT5) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLKTVHQKAGRHTRPVRAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLIAVVFALFAA FPMFSDVSIQLRHFIFANFMPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYAI DSALNTIWRSKRTRPKVYSFAVYWMILTLGPLLAGVSLAISSYLLSLRWASDLNTVIDNV LHILPLLLSWISFWLLYSIVPTTRVPNRDALVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEADQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yihY |
Synonyms | yihY; STM4027; UPF0761 membrane protein YihY |
UniProt ID | Q8ZKT5 |
◆ Recombinant Proteins | ||
REG3A-1340HFL | Recombinant Full Length Human REG3A Protein, C-Flag-tagged | +Inquiry |
TF-2760C | Recombinant Chicken TF Protein, His-tagged | +Inquiry |
SYTL2-5590H | Recombinant Human SYTL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CD164-1592R | Recombinant Rhesus Monkey CD164 Protein, hIgG4-tagged | +Inquiry |
SLAMF1-5104H | Recombinant Human SLAMF1 Protein (Met1-Leu258), C-His tagged | +Inquiry |
◆ Native Proteins | ||
KLK3-8247H | Native Human Prostate Specific Antigen | +Inquiry |
PGK-100Y | Active Native Yeast 3-Phosphoglyceric Phosphokinase | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
HDL-397H | Native Human High Density Lipoprotein, DiI labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RASSF9-2493HCL | Recombinant Human RASSF9 293 Cell Lysate | +Inquiry |
TRAF6-818HCL | Recombinant Human TRAF6 293 Cell Lysate | +Inquiry |
PPP1R2P9-1402HCL | Recombinant Human PPP1R2P9 cell lysate | +Inquiry |
FKBP7-1314HCL | Recombinant Human FKBP7 cell lysate | +Inquiry |
SCO1-2026HCL | Recombinant Human SCO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yihY Products
Required fields are marked with *
My Review for All yihY Products
Required fields are marked with *
0
Inquiry Basket