Recombinant Full Length Upf0761 Membrane Protein Yihy(Yihy) Protein, His-Tagged
Cat.No. : | RFL776EF |
Product Overview : | Recombinant Full Length UPF0761 membrane protein yihY(yihY) Protein (P0A8K9) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yihY |
Synonyms | yihY; c4833; UPF0761 membrane protein YihY |
UniProt ID | P0A8K9 |
◆ Recombinant Proteins | ||
LACTB2-2999R | Recombinant Rat LACTB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCP1B-2401H | Recombinant Human DCP1B Protein, GST-tagged | +Inquiry |
Plcd1-8267M | Recombinant Mouse Plcd1 protein, His & T7-tagged | +Inquiry |
RAN-3780R | Recombinant Rhesus monkey RAN Protein, His-tagged | +Inquiry |
TPRG1L-6593H | Recombinant Human TPRG1L Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CP-26450TH | Native Human CP | +Inquiry |
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
Lectin-1741M | Active Native Musa Paradisiaca (Banana) Lectin Protein | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UNC45B-1886HCL | Recombinant Human UNC45B cell lysate | +Inquiry |
TNFRSF10A-2180HCL | Recombinant Human TNFRSF10A cell lysate | +Inquiry |
TMEM92-924HCL | Recombinant Human TMEM92 293 Cell Lysate | +Inquiry |
SLURP1-1642HCL | Recombinant Human SLURP1 cell lysate | +Inquiry |
ATP6V0D1-8588HCL | Recombinant Human ATP6V0D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yihY Products
Required fields are marked with *
My Review for All yihY Products
Required fields are marked with *
0
Inquiry Basket