Recombinant Full Length Salinibacter Ruber Atp-Dependent Zinc Metalloprotease Ftsh 2(Ftsh2) Protein, His-Tagged
Cat.No. : | RFL36162SF |
Product Overview : | Recombinant Full Length Salinibacter ruber ATP-dependent zinc metalloprotease FtsH 2(ftsH2) Protein (D5HA94) (1-683aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salinibacter ruber |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-683) |
Form : | Lyophilized powder |
AA Sequence : | MADQTSQNDNQNGSGLPGGGPSGTGRGRLIIWVIAGTLLALWAYSYWGMGASGGERISYS EFRTQLQQENVERVEVKGNAINGSLKSQATRSEQGNTIEYQNFVTYLPSFGDEQLMDLLE SQGVNVVTKPESSFPWGLVIMGLLPVLLLFGVGYIFLRRMQSQGQGLFSVRQSKAELYDK DEEDTTFDDVAGADSAKEELREIIKFLKNPKRFEGLGGKVPKGVLLVGPPGTGKTLLARA VAGEANAPFFSVSGSDFMEMFVGVGASRVRDMFSEAKETSPAIIFIDELDSIGRKRGAGL GGGNDEREQTLNQLLSELDGFEENEGVIVMAATNRPDILDSALTRPGRFDRQITVDLPTK QSRHEILKIHAREKPLSDDVDLEEIARSTPGFSGADLENLLNEAALLAGRHGHDAIQYSD IEQARDKVMMGLKRDGMVLDDEEKKLLAYHEAGHAIVGAVLPNADPVHKVTIVPRGKAMG VTQQLPEKDQYLYRHDYILDRLAVIMGGRAAEELIFDTATSGAENDLKQVRKMARKMVLD WGMGDQFKHISLGEDQGNVFLGDEIAKGREYSDDTAREVDEEIRRISEDAFQRAVDTLNE HHEAFDQLADMLIEQEEVSGKDVLNLVNGDTDEIGHMPTTNGAAASEENGSADDHEPDEA TVIEEDGESGEGRASGSADASGS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH2 |
Synonyms | ftsH2; SRM_02028; ATP-dependent zinc metalloprotease FtsH 2 |
UniProt ID | D5HA94 |
◆ Recombinant Proteins | ||
TRIM32-4773H | Recombinant Human TRIM32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCL7-2955HF | Recombinant Full Length Human CCL7 Protein, GST-tagged | +Inquiry |
NS1-359V | Recombinant Dengue Virus 3 NS1 + V5 Protein, His-tagged | +Inquiry |
Chek2-5172MF | Recombinant Mouse Chek2 Protein, His/GST-tagged, FITC conjugated | +Inquiry |
SRD5A3-5736R | Recombinant Rat SRD5A3 Protein | +Inquiry |
◆ Native Proteins | ||
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
Cyfra-21-1-01H | Native Human MCF-7 Cell Cyfra-21-1 Antigen | +Inquiry |
ICDH-209S | Active Native Swine Isocitrate Dehydrogenase | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
VTN-31736TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
NETO1-2197HCL | Recombinant Human NETO1 cell lysate | +Inquiry |
SMAD5-001MCL | Recombinant Mouse SMAD5 cell lysate | +Inquiry |
ANK1-75HCL | Recombinant Human ANK1 cell lysate | +Inquiry |
SPRR4-1492HCL | Recombinant Human SPRR4 293 Cell Lysate | +Inquiry |
NASP-3966HCL | Recombinant Human NASP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH2 Products
Required fields are marked with *
My Review for All ftsH2 Products
Required fields are marked with *
0
Inquiry Basket