Recombinant Full Length Phalaenopsis Aphrodite Subsp. Formosana Photosystem Ii Cp47 Chlorophyll Apoprotein(Psbb) Protein, His-Tagged
Cat.No. : | RFL21062PF |
Product Overview : | Recombinant Full Length Phalaenopsis aphrodite subsp. formosana Photosystem II CP47 chlorophyll apoprotein(psbB) Protein (Q3BAL2) (1-508aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Phalaenopsis aphrodite subsp. formosana (Moth orchid) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-508) |
Form : | Lyophilized powder |
AA Sequence : | MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGTITNPGIWSYEGVAGAHILFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGIACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGHELFVRRMP TFFETFPVVLVDADGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVIYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | psbB |
Synonyms | psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47 |
UniProt ID | Q3BAL2 |
◆ Recombinant Proteins | ||
NDNF-2967R | Recombinant Rhesus monkey NDNF Protein, His-tagged | +Inquiry |
UQCRC1-6113R | Recombinant Rat UQCRC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH-RS00410-6168S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS00410 protein, His-tagged | +Inquiry |
RFL5386SF | Recombinant Full Length Staphylococcus Aureus Multidrug Resistance Efflux Pump Sepa(Sepa) Protein, His-Tagged | +Inquiry |
EXTL1-3587H | Recombinant Human EXTL1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
DENV2-01DCL | Native DENV2 Lysate | +Inquiry |
Prothrombin-60H | Native Human Prothrombin Frag 2 | +Inquiry |
Cpn-33 | Native Premium Chlamydia pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRN2-4618HCL | Recombinant Human LRRN2 293 Cell Lysate | +Inquiry |
IFNA8-1035CCL | Recombinant Cynomolgus IFNA8 Overexpression Lysate(Met1-Glu189) | +Inquiry |
PDLIM7-1326HCL | Recombinant Human PDLIM7 cell lysate | +Inquiry |
Ileum-473C | Cat Ileum Lysate, Total Protein | +Inquiry |
CD1B & B2M-001HCL | Recombinant Human CD1B & B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All psbB Products
Required fields are marked with *
My Review for All psbB Products
Required fields are marked with *
0
Inquiry Basket