Recombinant Full Length Saccharomyces Cerevisiae Very Long-Chain Fatty Acid Transport Protein(Fat1) Protein, His-Tagged
Cat.No. : | RFL36084SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Very long-chain fatty acid transport protein(FAT1) Protein (P38225) (1-669aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-669) |
Form : | Lyophilized powder |
AA Sequence : | MSPIQVVVFALSRIFLLLFRLIKLIITPIQKSLGYLFGNYFDELDRKYRYKEDWYIIPYF LKSVFCYIIDVRRHRFQNWYLFIKQVQQNGDHLAISYTRPMAEKGEFQLETFTYIETYNI VLRLSHILHFDYNVQAGDYVAIDCTNKPLFVFLWLSLWNIGAIPAFLNYNTKGTPLVHSL KISNITQVFIDPDASNPIRESEEEIKNALPDVKLNYLEEQDLMHELLNSQSPEFLQQDNV RTPLGLTDFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVLHMTNESTVFTAMPLF HSTAALLGACAILSHGGCLALSHKFSASTFWKQVYLTGATHIQYVGEVCRYLLHTPISKY EKMHKVKVAYGNGLRPDIWQDFRKRFNIEVIGEFYAATEAPFATTTFQKGDFGIGACRNY GTIIQWFLSFQQTLVRMDPNDDSVIYRNSKGFCEVAPVGEPGEMLMRIFFPKKPETSFQG YLGNAKETKSKVVRDVFRRGDAWYRCGDLLKADEYGLWYFLDRMGDTFRWKSENVSTTEV EDQLTASNKEQYAQVLVVGIKVPKYEGRAGFAVIKLTDNSLDITAKTKLLNDSLSRLNLP SYAMPLFVKFVDEIKMTDNHKILKKVYREQKLPKGLDGNDTIFWLKNYKRYEVLTAADWE AIDAQTIKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAT1 |
Synonyms | FAT1; YBR041W; YBR0411; Very long-chain fatty acid transport protein; Very-long-chain acyl-CoA synthetase; VLCS |
UniProt ID | P38225 |
◆ Recombinant Proteins | ||
RABGAP1-2140H | Recombinant Human RABGAP1, GST-tagged | +Inquiry |
Ifngr2-6955M | Recombinant Mouse Ifngr2 protein, His-tagged | +Inquiry |
TMEM39A-6167R | Recombinant Rat TMEM39A Protein | +Inquiry |
VEGFA-271H | Recombinant Human VEGFA, Biotinylated | +Inquiry |
Cd320-979M | Recombinant Mouse Cd320 Protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
Proteoglycans-52H | Native Human Proteoglycans | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
KLKB1-210H | Active Native Human Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
POMP-3017HCL | Recombinant Human POMP 293 Cell Lysate | +Inquiry |
SLC25A46-1758HCL | Recombinant Human SLC25A46 293 Cell Lysate | +Inquiry |
Spleen-467H | Human Spleen Lupus Lysate | +Inquiry |
DUSP15-515HCL | Recombinant Human DUSP15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAT1 Products
Required fields are marked with *
My Review for All FAT1 Products
Required fields are marked with *
0
Inquiry Basket