Recombinant Full Length Cochliobolus Heterostrophus Fatty Acid Transporter Protein(Fat1) Protein, His-Tagged
Cat.No. : | RFL12666CF |
Product Overview : | Recombinant Full Length Cochliobolus heterostrophus Fatty acid transporter protein(FAT1) Protein (O42633) (1-643aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cochliobolus heterostrophus (Southern corn leaf blight fungus) (Bipolaris maydis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-643) |
Form : | Lyophilized powder |
AA Sequence : | MACMHQAQLYNDLEELLTGPSVPIVAGAAGAAALTAYINAKYHIAHDLKTLGGGLTQSSE AIDFINRRVAQKRVLTHHIFQEQVQKQSNHPFLIFEGKTWSYKEFSEAYTRVANWLIDEL DVQVGEMVAIDGGNSAEHLMLWLALDAIGAATSFLNWNLTGAGLIHCIKLCECRFVIADI DIKANIEPCRGELEETGINIHYYDPSFISSLPNNTPIPDSRTENIELDSVRGLIYTSGTT GLPKGVFISTGRELRTDWSISKYLNLKPTDRMYTCMPLYHAAAHSLCTASVIHGGGTVVL SRKFSHKKFWPEVVASEANIIQYVGELGRYLLNGPKSPYDRAHKVQMAWGNGMRPDVWEA FRERFNIPIIHELYAATDGLGSMTNRNAGPFTANCIALRGLIWHWKFRNQEVLVKMDLDT DEIMRDRNGFAIRCAVNEPGQMLFRLTPETLAGAPSYYNNETATQSRRITDVFQKGDLWF KSGDMLRQDAEGRVYFVDRLGDTFRWKSENVSTNEVADVMGTFPQIAETNVYGVLVPGND GRVRSLNCHGRRRDRVDIRFAALAKHARDRLPGYAVPLFLRVTPALEYTGTLKIQKGRLK QEGIDPDKISGEDKLYWLPPGSDIYLPFGKMEWQGIVDKRIRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAT1 |
Synonyms | FAT1; Very long-chain fatty acid transport protein; Very-long-chain acyl-CoA synthetase; VLCS |
UniProt ID | O42633 |
◆ Recombinant Proteins | ||
CRP7-5937Z | Recombinant Zebrafish CRP7 | +Inquiry |
SLC38A3-5525R | Recombinant Rat SLC38A3 Protein | +Inquiry |
RFL5776CF | Recombinant Full Length Cyprinus Carpio Acyl-Coa Desaturase Protein, His-Tagged | +Inquiry |
PHF16-12721M | Recombinant Mouse PHF16 Protein | +Inquiry |
E2F1-2016H | Recombinant Human E2F1 Protein (Val88-Phe437), N-His tagged | +Inquiry |
◆ Native Proteins | ||
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
IgE-01M | Native Mouse IgE protein | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
Complement C5a-54H | Native Human Complement C5a | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACE-9094HCL | Recombinant Human ACE 293 Cell Lysate | +Inquiry |
NUDT8-1228HCL | Recombinant Human NUDT8 cell lysate | +Inquiry |
BFSP1-64HCL | Recombinant Human BFSP1 lysate | +Inquiry |
PAXBP1-240HCL | Recombinant Human PAXBP1 cell lysate | +Inquiry |
PSAP-2792HCL | Recombinant Human PSAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAT1 Products
Required fields are marked with *
My Review for All FAT1 Products
Required fields are marked with *
0
Inquiry Basket