Recombinant Full Length Saccharomyces Cerevisiae Vacuolar Membrane Protein Scrg_03194 (Scrg_03194) Protein, His-Tagged
Cat.No. : | RFL11845SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Vacuolar membrane protein SCRG_03194 (SCRG_03194) Protein (B3LNR8) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MVKKNFIPSVSLVRRDLPTLVTTTTSSTALSKPTSSVVSETSSKSLPSLTSSAFSTSSGA TSSSSLIVASITPPSTAGNPFILNAADKPNGTVYIAVGAVIGAIFISILIWWLVSSYLSR RFTMTNSYANDSKNLYRGHHKHSSSLQSNPFDINDEKSYMQDDWDSMSQLESSQYEDAAS PFNPIQDPFTDNRRSLFISPTLQVSQYEKSHSRHQSKDTNIFIDDPSLYVGTYLEEEEEE ERKLNLNRPQRAASPERKEKKINSMEGYHKRNQSSLGLIPVASATSNTSSPKKAHKRQAP SMFLDDVLNGREII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCRG_03194 |
Synonyms | SCRG_03194; Vacuolar membrane protein SCRG_03194 |
UniProt ID | B3LNR8 |
◆ Recombinant Proteins | ||
NKG2A-3258H | Recombinant Human NKG2A protein(Arg100-Leu233), His-tagged | +Inquiry |
AURKA-278H | Recombinant Human AURKA Protein, His&GST-tagged | +Inquiry |
GLRX2-2226R | Recombinant Rat GLRX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CYGB2-2987Z | Recombinant Zebrafish CYGB2 | +Inquiry |
CLYBL-1897HF | Recombinant Full Length Human CLYBL Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
IgG-347G | Native Guinea Pig Gamma Globulin Fraction | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNOT8-7398HCL | Recombinant Human CNOT8 293 Cell Lysate | +Inquiry |
CRCP-7291HCL | Recombinant Human CRCP 293 Cell Lysate | +Inquiry |
NUDT3-1227HCL | Recombinant Human NUDT3 cell lysate | +Inquiry |
RAD17-2562HCL | Recombinant Human RAD17 293 Cell Lysate | +Inquiry |
EYA2-6491HCL | Recombinant Human EYA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SCRG_03194 Products
Required fields are marked with *
My Review for All SCRG_03194 Products
Required fields are marked with *
0
Inquiry Basket