Recombinant Full Length Human CLYBL Protein, GST-tagged

• Cat.No.: CLYBL-1897HF
• Product Overview: Human CLYBL full-length ORF ( AAH34360.1, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 340 amino acids
• Description: CLYBL (Citrate Lyase Beta Like) is a Protein Coding gene. Diseases associated with CLYBL include Dermatophytosis. GO annotations related to this gene include lyase activity.
• Molecular Mass: 63.7 kDa
• AA Sequence: MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLYBL citrate lyase beta like [ Homo sapiens ]
• Official Symbol: CLYBL
• Synonyms: CLYBL; citrate lyase beta like; citrate lyase subunit beta-like protein, mitochondrial; CLB; citrate lyase beta-like; bA134O15.1
• Gene ID: 171425
• mRNA Refseq: NM_206808
• Protein Refseq: NP_996531
• MIM: 609686
• UniProt ID: Q8N0X4