Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Protein Ypr153W (Ypr153W) Protein, His-Tagged
Cat.No. : | RFL24533SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized protein YPR153W (YPR153W) Protein (Q06537) (1-140aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-140) |
Form : | Lyophilized powder |
AA Sequence : | MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC AVVQILFDVVLSYSMVGSVM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YPR153W |
Synonyms | YPR153W; Uncharacterized protein YPR153W |
UniProt ID | Q06537 |
◆ Recombinant Proteins | ||
RFL25905TF | Recombinant Full Length Pyrococcus Kodakaraensis Upf0290 Protein Tk2119(Tk2119) Protein, His-Tagged | +Inquiry |
SARS-CoV-2-12PsV | SARS-CoV-2 Pseudoviral Particles, Lambda Variant (C.37) | +Inquiry |
ILF2-3050R | Recombinant Rat ILF2 Protein | +Inquiry |
MOG-4585H | Recombinant Human MOG Protein (Gly30-Tyr149), His tagged | +Inquiry |
KLRD1-4910H | Recombinant Human KLRD1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
GPIIbIIIa-73H | Native Human GPIIbIIIa | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC20-7668HCL | Recombinant Human CDC20 293 Cell Lysate | +Inquiry |
NTRK1-963CCL | Recombinant Canine NTRK1 cell lysate | +Inquiry |
CHRD-7524HCL | Recombinant Human CHRD 293 Cell Lysate | +Inquiry |
TRNAU1AP-750HCL | Recombinant Human TRNAU1AP 293 Cell Lysate | +Inquiry |
HSPA1L-5356HCL | Recombinant Human HSPA1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YPR153W Products
Required fields are marked with *
My Review for All YPR153W Products
Required fields are marked with *
0
Inquiry Basket