Recombinant Full Length Pyrococcus Kodakaraensis Upf0290 Protein Tk2119(Tk2119) Protein, His-Tagged

• Cat.No.: RFL25905TF
• Product Overview: Recombinant Full Length Pyrococcus kodakaraensis UPF0290 protein TK2119(TK2119) Protein (Q5JEX0) (1-171aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length (1-171)
• AA Sequence: MGWLSSIFWAFWYILPAYFANASPVLVGGGRPIDGGRVWRDGRRLLGDGKTWRGFIGGVL IGTLVGIVQYFITPDFYGSLETAVKLAFLLSFGALIGDLVGSFIKRRANLPRGYPAIGLD QLGFLISALAFAYPVKTLSSGQIIFLLVVSPFIHWGANYFAYRMGWKSVPW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: carS
• Synonyms: carS; TK2119; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
• UniProt ID: Q5JEX0