Recombinant Full Length Saccharomyces Cerevisiae Uncharacterized Membrane Protein Ygr149W (Ygr149W) Protein, His-Tagged
Cat.No. : | RFL16675SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Uncharacterized membrane protein YGR149W (YGR149W) Protein (P48236) (1-432aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-432) |
Form : | Lyophilized powder |
AA Sequence : | MYKLDNNDIDDETNNSVSLTSLLEFLDPIASKVVSKYYHGSHLSKAEQKLRNFEGFRRRK PHHEHDSHHPHHLNRSRSFLQLEDFKVRALQRIRNLDKPLDSIFFKNSSRLEKAFYPFTL FNIFFIGFLMGRFPEWFHVYYTILFFVLMPIRFYTYYKTKNHYFLADFCYFVNMLCLLFI WIFPYSYSLFQSCFAFTFGTLCFAVITWRNSLVIHSIDKTTSCFIHIIPPCVMYVIYHGL PLEYKIERFPGAIIQSELDIKKNILWTSLYYLVWQSLYHYFITLKKSSKIKSGERMTSFE YLTTHQFKNFWAVKLRSPWPMIIYTLSQYFYQLFTMLLCGIWIRYKLAAALFLTIVFLWA SHNGATYYIDHYGKNFEKEVDRLRLEVENLQQKLQPDSDAVISDASVNDKDYLNVNRDED FDDSSSVSSKSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YGR149W |
Synonyms | GPC1; YGR149W; G6639; Glycerophosphocholine acyltransferase 1; GPCAT |
UniProt ID | P48236 |
◆ Recombinant Proteins | ||
PDCD1LG2-586H | Active Recombinant Human PDCD1LG2, HIgG1 Fc-tagged, mutant | +Inquiry |
RFL6052DF | Recombinant Full Length Drosophila Yakuba Calcium Channel Flower(Flower) Protein, His-Tagged | +Inquiry |
ABI1-6323H | Recombinant Human ABI1 protein, GST-tagged | +Inquiry |
TRIM72-3379H | Recombinant Human TRIM72 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IDNK-2671HF | Recombinant Full Length Human IDNK Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
CTSD-189H | Active Native Human Cathepsin D | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
CSH1-31024TH | Native Human CSH1 | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLSTN2-7430HCL | Recombinant Human CLSTN2 293 Cell Lysate | +Inquiry |
CD68-2291HCL | Recombinant Human CD68 cell lysate | +Inquiry |
MRPL41-4168HCL | Recombinant Human MRPL41 293 Cell Lysate | +Inquiry |
RRP8-2140HCL | Recombinant Human RRP8 293 Cell Lysate | +Inquiry |
ALAD-54HCL | Recombinant Human ALAD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YGR149W Products
Required fields are marked with *
My Review for All YGR149W Products
Required fields are marked with *
0
Inquiry Basket