Recombinant Full Length Saccharomyces Cerevisiae Sphingoid Long-Chain Base Transporter Rsb1(Rsb1) Protein, His-Tagged
Cat.No. : | RFL5838SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1(RSB1) Protein (C8ZI10) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGYIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAMTVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGRSTSIPITPGHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RSB1 |
Synonyms | RSB1; EC1118_1O4_2476g; Sphingoid long-chain base transporter RSB1 |
UniProt ID | C8ZI10 |
◆ Native Proteins | ||
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
IgG-342R | Native RABBIT IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
GRM2-5736HCL | Recombinant Human GRM2 293 Cell Lysate | +Inquiry |
ZAP70-1948HCL | Recombinant Human ZAP70 cell lysate | +Inquiry |
C11orf52-8345HCL | Recombinant Human C11orf52 293 Cell Lysate | +Inquiry |
SV-T2-050WCY | Mouse BALB/3T3 embryo fibroblast cell, SV40 transformed, clone A31 SV-T2 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RSB1 Products
Required fields are marked with *
My Review for All RSB1 Products
Required fields are marked with *
0
Inquiry Basket