Recombinant Full Length Saccharomyces Cerevisiae Sphingoid Long-Chain Base Transporter Rsb1(Rsb1) Protein, His-Tagged
Cat.No. : | RFL32335SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Sphingoid long-chain base transporter RSB1(RSB1) Protein (B5VRU8) (1-382aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-382) |
Form : | Lyophilized powder |
AA Sequence : | MSNATNNTLGSLLPQLEAAANSNSLYGGMVPNLRFNITMIVIWGILLTIHVVQLLMRQYW FSIAFICTGILEVLGFIGRTWSHSNVADMDAFLLNMICLTIAPVFTMGGIYYQLAKLIEV YGHRFSLLPSPMAYSFIFICSDIVSLVVQAVGGGLCGVAVTDGTSTTTGNHVFIAGLAIQ VASMAIFLMLWFHFLFRIYISVRWEHINSRPISLSLLKISQTEVDYLYREKFHFLRLEPK RWVFHYFNLAMTVAVLTIFTRCCYRLAELVVGWDGYLITHEWYFIILDALMMAIATVTLT IFHPGFAFKGRSTSIPITPRHVDPETLPHTDDVEDILDTSDSKQFDIEKEEFQASMKYPI STFKQFMSKIANLFSSKKKAKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RSB1 |
Synonyms | RSB1; AWRI1631_152100; Sphingoid long-chain base transporter RSB1 |
UniProt ID | B5VRU8 |
◆ Native Proteins | ||
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
CAT-101B | Active Native Bovine CAT | +Inquiry |
S100a6-43M | Native Mouse S100A6 | +Inquiry |
Thrombin-30B | Active Native Bovine alpha-Thrombin-BFPRck, Biotin-tagged | +Inquiry |
C3-05M | Native Mouse C3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Kidney-269M | Mouse Kidney Membrane Lysate | +Inquiry |
AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
RBM5-2466HCL | Recombinant Human RBM5 293 Cell Lysate | +Inquiry |
RELL2-2422HCL | Recombinant Human RELL2 293 Cell Lysate | +Inquiry |
SASS6-1562HCL | Recombinant Human SASS6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RSB1 Products
Required fields are marked with *
My Review for All RSB1 Products
Required fields are marked with *
0
Inquiry Basket