Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Yll059C(Yll059C) Protein, His-Tagged
Cat.No. : | RFL16454SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Putative uncharacterized protein YLL059C(YLL059C) Protein (Q12336) (1-168aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-168) |
Form : | Lyophilized powder |
AA Sequence : | MCMCVVLVYFSILLDKGTKVLYTHDNNWLVILVFYFLAFGSIMRISGRTCSEEMKKSFGQ ASYHNGLQNFSKESPVGVNLEKKKTHISCCIILATQRFLQKFSNKRLGNPHLHPTRESTF SRELATENNSGNFPVLLRYHIFRQLDIENGILLCQVLQALIIVQVMFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YLL059C |
Synonyms | YLL059C; L0563; Putative uncharacterized protein YLL059C |
UniProt ID | Q12336 |
◆ Native Proteins | ||
Glutamate oxaloacetate transaminase-385 | Active Native E. coli Glutamate oxaloacetate transaminase protein. | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
COLV-19B | Native Bovine COLV Protein | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF124-144HCL | Recombinant Human ZNF124 293 Cell Lysate | +Inquiry |
DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
FBXO25-6303HCL | Recombinant Human FBXO25 293 Cell Lysate | +Inquiry |
FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YLL059C Products
Required fields are marked with *
My Review for All YLL059C Products
Required fields are marked with *
0
Inquiry Basket