Recombinant Full Length Saccharomyces Cerevisiae Protein Yip5(Yip5) Protein, His-Tagged
Cat.No. : | RFL31488SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein YIP5(YIP5) Protein (P53108) (1-310aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-310) |
Form : | Lyophilized powder |
AA Sequence : | MPSNNSSFLDIDDDLEGVDDFGNEPNPFDDATVPDSPNMNNSTAGKGSEFYNTTGSKAES APLQGQMDPPAYDQVIGQNDNDGLGRNGLRPGLINYYSKYFQIDLTQFKKRLSAVLTFRN DHNSESNEDNTDLYGAVWITATVVMINFTMSRGLNFIISDVIEGVKTGEDIDRASQFKKL LHSIWLFYGYTFGVPFITMQVLNRDEHSERNRSFKSVPELISVYGYANLIWIPVCVILNI LDMSKRLRTVQAIQWAIVALGWAQSSYFLNSQISSNNNTETQSNGKFSLSIIVVVALHTL FCLLFRFIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YIP5 |
Synonyms | YIP5; YGL161C; G1832; Protein YIP5; YPT-interacting protein 5 |
UniProt ID | P53108 |
◆ Native Proteins | ||
APOH-5365H | Native Human Apolipoprotein H (beta-2-glycoprotein I) | +Inquiry |
KLK3-387H | Native Human Prostate Specific Antigen (PSA), Low pI Isoform (IEF) | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
HPX-206H | Native Human Native Human HPX | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF764-13HCL | Recombinant Human ZNF764 293 Cell Lysate | +Inquiry |
OMP-1250HCL | Recombinant Human OMP cell lysate | +Inquiry |
MEIS3-4369HCL | Recombinant Human MEIS3 293 Cell Lysate | +Inquiry |
RILPL1-649HCL | Recombinant Human RILPL1 cell lysate | +Inquiry |
CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All YIP5 Products
Required fields are marked with *
My Review for All YIP5 Products
Required fields are marked with *
0
Inquiry Basket