Recombinant Full Length Saccharomyces Cerevisiae Protein Erd1(Erd1) Protein, His-Tagged
Cat.No. : | RFL21113SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Protein ERD1(ERD1) Protein (P16151) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MEKSESNSEGLYLQNILNVPPPQRFIVLIILALWIWTWILKFFLHSNLDVSQVILTRVPH DIRPGYTLQQLHRTARNFALKITRIIIPFHFATVFLFEFMNIIEGPLKNIILIVYFLPLI QCVTIFWFLLKECQIIKYCTRRCLLIESSPRSLRNTYILISDTLTSFAKPLIDFTLFTSL IFREPFTHFDLSVALLPVLVRLLQCLREYRLLHEATLLFNALKYSCNLPILFCTWRSRVY EGSINEERLHHVQRWFMLINSSYTLFWDVRMDWSLDSLTSLRSRSKSAVTLKKKMYHSAI LVDFLLRFWWLWVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKLDAEYYIKFA SK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERD1 |
Synonyms | ERD1; YDR414C; D9461.4; Protein ERD1 |
UniProt ID | P16151 |
◆ Recombinant Proteins | ||
RFL20517CF | Recombinant Full Length Caenorhabditis Remanei Cytochrome C Oxidase Subunit 2(Cox-2) Protein, His-Tagged | +Inquiry |
CCDC153-1176R | Recombinant Rat CCDC153 Protein | +Inquiry |
SPHK1-1331H | Acitve Recombinant Human SPHK1 protein(Met1-Leu384) | +Inquiry |
Sin a 1-643S | Recombinant Sinapis alba allergen 1.0101 protein (Allergen Sin a 1), His-tagged | +Inquiry |
AGT-95H | Recombinant Human AGT Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
BSI-B4-852 | Active Native Bandeiraea simplicifolia Isolectin B4 protein | +Inquiry |
ACTN3-3280C | Native Chicken ACTN3 | +Inquiry |
TF-136C | Native Chicken Ovotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Colon-85R | Rhesus monkey Colon Lysate | +Inquiry |
HNRNPU-5439HCL | Recombinant Human HNRNPU 293 Cell Lysate | +Inquiry |
CD274-914CCL | Recombinant Cynomolgus CD274 cell lysate | +Inquiry |
ADAMTSL4-27HCL | Recombinant Human ADAMTSL4 cell lysate | +Inquiry |
GAPVD1-686HCL | Recombinant Human GAPVD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERD1 Products
Required fields are marked with *
My Review for All ERD1 Products
Required fields are marked with *
0
Inquiry Basket