Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL3531SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (E7NIY5) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIXVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFST QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; FOSTERSO_2274; Pheromone-regulated membrane protein 5 |
UniProt ID | E7NIY5 |
◆ Native Proteins | ||
Lectin-1760A | Active Native Agaricus bisporus lectin Protein | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
PROC-269B | Active Native Bovine Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL23-2215HCL | Recombinant Human RPL23 293 Cell Lysate | +Inquiry |
CNOT2-7403HCL | Recombinant Human CNOT2 293 Cell Lysate | +Inquiry |
CEACAM8-2246HCL | Recombinant Human CEACAM8 cell lysate | +Inquiry |
RPL26-2213HCL | Recombinant Human RPL26 293 Cell Lysate | +Inquiry |
HIST1H2BF-5540HCL | Recombinant Human HIST1H2BF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket