Recombinant Full Length Saccharomyces Cerevisiae Pheromone-Regulated Membrane Protein 5(Prm5) Protein, His-Tagged
Cat.No. : | RFL10366SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Pheromone-regulated membrane protein 5(PRM5) Protein (B3LTW4) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSR NGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFST QHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFER PLSSLVSESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTIS SSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRK PTPSTYLEHMLEGKEQDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRM5 |
Synonyms | PRM5; SCRG_05289; Pheromone-regulated membrane protein 5 |
UniProt ID | B3LTW4 |
◆ Recombinant Proteins | ||
CALR-27213TH | Recombinant Human CALR | +Inquiry |
YAAT-0820B | Recombinant Bacillus subtilis YAAT protein, His-tagged | +Inquiry |
FST-1617H | Recombinant Human Follistatin | +Inquiry |
TAC4-16371M | Recombinant Mouse TAC4 Protein | +Inquiry |
TGFB2-287H | Active Recombinant Human TGFB2 Protein (Ala303-Ser414), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
MBP-99S | Native Swine MBP | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
PGA-130H | Active Native Human Pepsinogen I | +Inquiry |
KLC-212H | Native Human Kappa Light Chain | +Inquiry |
NUC-0003 | Native Human Nucleosome | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR2-001MCL | Recombinant Mouse FGFR2 cell lysate | +Inquiry |
FUT2-6115HCL | Recombinant Human FUT2 293 Cell Lysate | +Inquiry |
GATSL3-6004HCL | Recombinant Human GATSL3 293 Cell Lysate | +Inquiry |
RAPGEF5-1469HCL | Recombinant Human RAPGEF5 cell lysate | +Inquiry |
TGIF1-1115HCL | Recombinant Human TGIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PRM5 Products
Required fields are marked with *
My Review for All PRM5 Products
Required fields are marked with *
0
Inquiry Basket