Recombinant Full Length Saccharomyces Cerevisiae Ph-Response Regulator Protein Pali/Rim9(Rim9) Protein, His-Tagged
Cat.No. : | RFL2688SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae pH-response regulator protein palI/RIM9(RIM9) Protein (Q04734) (1-239aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-239) |
Form : | Lyophilized powder |
AA Sequence : | MVSMIHIVVFLLAITTMFEILPLITVPVTKYLSLSSFRNHYYGLFGWCVRGQNQELMCTK MKIGYDSTDVDSSGHVLTLPSNSKVVVSNLLVVHPISLAFTGTLLILAVIIMVTPLGDSP EMLLFTALFSLPTFMLCLLCFLVDILLFISKLDWPGWLMLAATISVALCCSMLWVMRRVV SVKKYESQQSIAHACSMEQYSISDIYQSKQNGNSSEYEVAPTHTDSLIAPEVTYRGFIE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM9 |
Synonyms | RIM9; YMR063W; YM9916.02; pH-response regulator protein palI/RIM9; Regulator of IME2 protein 9 |
UniProt ID | Q04734 |
◆ Recombinant Proteins | ||
SND1-5300R | Recombinant Rat SND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDKL5-1052H | Recombinant Human CDKL5 Protein, GST-Tagged | +Inquiry |
CLEC9A-2092H | Recombinant Human CLEC9A Protein (Lys57-Val241), C-His tagged | +Inquiry |
DTD2-1209Z | Recombinant Zebrafish DTD2 | +Inquiry |
TSGA10IP-6315R | Recombinant Rat TSGA10IP Protein | +Inquiry |
◆ Native Proteins | ||
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
LDL-402H | Native Human Low Density Lipoprotein, High Oxidized, DiI labeled | +Inquiry |
FGB-01P | Native Porcine Fibrinogen Protein, FITC Labeled | +Inquiry |
Kidney-003H | Human Kidney Lysate, Total Protein | +Inquiry |
CFB-104H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAD-8529HCL | Recombinant Human BAD 293 Cell Lysate | +Inquiry |
ZP2-9193HCL | Recombinant Human ZP2 293 Cell Lysate | +Inquiry |
IL27RA-2909HCL | Recombinant Human IL27RA cell lysate | +Inquiry |
H3F3B-5653HCL | Recombinant Human H3F3B 293 Cell Lysate | +Inquiry |
CD28-2002MCL | Recombinant Mouse CD28 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RIM9 Products
Required fields are marked with *
My Review for All RIM9 Products
Required fields are marked with *
0
Inquiry Basket