Recombinant Full Length Saccharomyces Cerevisiae Nuclear Fusion Protein Fus1(Fus1) Protein, His-Tagged
Cat.No. : | RFL36105SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Nuclear fusion protein FUS1(FUS1) Protein (P11710) (1-512aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-512) |
Form : | Lyophilized powder |
AA Sequence : | MVATIMQTTTTVLTTVAAMSTTLASNYISSQASSSTSVTTVTTIATSIRSTPSNLLFSNV AAQPKSSSASTIGLSIGLPIGIFCFGLLILLCYFYLKRNSVSISNPPMSATIPREEEYCR RTNWFSRLFWQSKCEDQNSYSNRDIEKYNDTQWTSGDNMSSKIQYKISKPIIPQHILTPK KTVKNPYAWSGKNISLDPKVNEMEEEKVVDAFLYTKPPNIVHIESSMPSYNDLPSQKTVS SKKTALKTSEKWSYESPLSRWFLRGSTYFKDYGLSKTSLKTPTGAPQLKQMKMLSRISKG YFNESDIMPDERSPILEYNNTPLDANDSVNNLGNTTPDSQITSYRNNNIDLITARPHSVI YGTTAQQTLETNFNDHHDCNKSTEKHELIIPTPSKPLKKRKKRRQSKMYQHLQHLSRSKP LPLTPNSKYNGEASVQLGKTYTVIQDYEPRLTDEIRISLGEKVKILATHTDGWCLVEKCN TQKGSIHVSVDDKRYLNEDRGIVPGDCLQEYD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FUS1 |
Synonyms | FUS1; YCL027W; YCL27W; Nuclear fusion protein FUS1 |
UniProt ID | P11710 |
◆ Recombinant Proteins | ||
RFL8294NF | Recombinant Full Length Neurospora Crassa Bifunctional Lycopene Cyclase/Phytoene Synthase(Al-2) Protein, His-Tagged | +Inquiry |
HS1BP3-4321M | Recombinant Mouse HS1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADAMTS13-2684M | Recombinant Mouse ADAMTS13 Protein (904-1137 aa), His-Myc-tagged | +Inquiry |
ACR-3079R | Recombinant Rat ACR, His-tagged | +Inquiry |
TSPYL4-3464H | Recombinant Human TSPYL4, His-tagged | +Inquiry |
◆ Native Proteins | ||
SLC40A1-5335H | Native Human Solute Carrier Family 40 (iron-regulated transporter), Member 1 | +Inquiry |
F10-28S | Native Snake Russells Viper Venom Factor X Activator | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
MG-41H | Active Native Human MG | +Inquiry |
TNC-08H | Native Human TNC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Stomach-676H | Hamster Stomach Lysate, Total Protein | +Inquiry |
TMOD1-917HCL | Recombinant Human TMOD1 293 Cell Lysate | +Inquiry |
TRIM60-1831HCL | Recombinant Human TRIM60 cell lysate | +Inquiry |
SPCS3-1525HCL | Recombinant Human SPCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUS1 Products
Required fields are marked with *
My Review for All FUS1 Products
Required fields are marked with *
0
Inquiry Basket