Recombinant Full Length Neurospora Crassa Bifunctional Lycopene Cyclase/Phytoene Synthase(Al-2) Protein, His-Tagged
Cat.No. : | RFL8294NF |
Product Overview : | Recombinant Full Length Neurospora crassa Bifunctional lycopene cyclase/phytoene synthase(al-2) Protein (P37295) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neurospora Crassa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MYDYAFVHLKFTVPAAVLLTAIAYPILNRIHLIQTGFLVVVAFTAALPWDAYLIKHKVWS YPPEAIVGPRLLGIPFEELFFFVIQTYITALVYILFNKPVLHALHLNNQQNPPAWMRVVK VTGQVVLVALSVWGWNAAQVHQETSYLGLILVWACPFLLAIWTLAGRFILSLPWYATVLP MFLPTFYLWAVDEFALHRGTWSIGSGTKLDFCLFGKLDIEEATFFLVTNMLIVGGMAAFD QYLAVIYAFPTLFPKVNRYPTTHMLLQSRLINTSRYDLERIEGLREAVERLRLKSRSFYL ANSLFSGRLRIDLILLYSFCRLADDLVDDAKSRREVLSWTAKLNHFLDLHYKDADATEDP KKKAERIDAYIKTAFPPCAYQALHLLPTHILPPKPLYDLIKGFEMDSQFTFHGTSDSTDL QYPIADDKDLENYAIYVAGTVGELCIALIIYHCLPDMSDTQKRELETAACRMGIALQYVN IARDIVVDARIGRVYLPTTWLKKEGLTHKMVLENPEGPEVIERMRRRLLENAFELYGGAR PEMQRIPSEARGPMIGAVENYMAIGRVLRERKEGTVFVRMEGRATVPKRRRLSTLLRALY EQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | al-2 |
Synonyms | al-2; B22I21.230; NCU00585; Bifunctional lycopene cyclase/phytoene synthase; Protein albino-2 [Includes: Lycopene beta-cyclase; Carotene cyclase; Lycopene cyclase; Phytoene synthase; ] |
UniProt ID | P37295 |
◆ Recombinant Proteins | ||
BMP7-10H | Recombinant Human Bone Morphogenetic Protein 7, His-tagged | +Inquiry |
RFL13723BF | Recombinant Full Length Bacillus Subtilis Stage V Sporulation Protein Aa(Spovaa) Protein, His-Tagged | +Inquiry |
RASGRP1-13953M | Recombinant Mouse RASGRP1 Protein | +Inquiry |
Gfra2-947M | Recombinant Mouse Gfra2 Protein, His-tagged | +Inquiry |
BCL6-26735TH | Recombinant Human BCL6 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
Cpn-33 | Native Premium Chlamydia pneumoniae Antigen | +Inquiry |
HP-26196TH | Native Human HP | +Inquiry |
a-AntiTrypsin-5911H | Active Native Human a-AntiTrypsin | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP2K-8434HCL | Recombinant Human BMP2K 293 Cell Lysate | +Inquiry |
ASF1B-001HCL | Recombinant Human ASF1B cell lysate | +Inquiry |
POLR3C-3026HCL | Recombinant Human POLR3C 293 Cell Lysate | +Inquiry |
RAX2-2491HCL | Recombinant Human RAX2 293 Cell Lysate | +Inquiry |
KIFC3-934HCL | Recombinant Human KIFC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All al-2 Products
Required fields are marked with *
My Review for All al-2 Products
Required fields are marked with *
0
Inquiry Basket