Recombinant Full Length Saccharomyces Cerevisiae N-Glycosylation Protein Eos1(Eos1) Protein, His-Tagged
Cat.No. : | RFL10551SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae N-glycosylation protein EOS1(EOS1) Protein (P53938) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MTWILSTGMGPHEDKYAKHERATFKKTYSSMKTLSLNHLTAKQHMLMALCRDISLLPPLT YIFTSLRKAWRVSMRTSITLYEPQSLRDAFTYFWQKLNSAYDNNSSFEGASQKAVNGDGK DSLLLSALTTARASEYLLCSLWCLVSLYLSYAILDSLMVRWIVKYSTVAAILRMFSMSLI IVTLELLLLSSLSPELDYFLHTWILISCVLTAVYIWQSYLTSDLRYIRNQEGEVQEDTNV PEETEDYEDGEDDADEDSHVVVADESTVDVPSNDSLSDNSDGGLFPVNRPSVSHSQSPKR PKKYPKKAFNFTTKRTIDLYKITVLCVVPVGLASFITMLGLLRNLFIQRLDVEQLERILH EMHPPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EOS1 |
Synonyms | EOS1; YNL080C; N2327; N-glycosylation protein EOS1; ER-localized and oxidants sensitive protein 1 |
UniProt ID | P53938 |
◆ Recombinant Proteins | ||
P3h1-4639M | Recombinant Mouse P3h1 Protein, Myc/DDK-tagged | +Inquiry |
AMFR-3783H | Recombinant Human AMFR, GST-tagged | +Inquiry |
DCAF8L2-1189R | Recombinant Rhesus monkey DCAF8L2 Protein, His-tagged | +Inquiry |
ABHD10-825HF | Recombinant Full Length Human ABHD10 Protein, GST-tagged | +Inquiry |
EDNRB-2642M | Recombinant Mouse EDNRB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VIM-186B | Native bovine VIM | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
XOD-22B | Native Bovine XOD Protein | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
C15orf23-8269HCL | Recombinant Human C15orf23 293 Cell Lysate | +Inquiry |
NRXN3-1914HCL | Recombinant Human NRXN3 cell lysate | +Inquiry |
ZNF302-97HCL | Recombinant Human ZNF302 293 Cell Lysate | +Inquiry |
HA-2333HCL | Recombinant H3N2 HA cell lysate | +Inquiry |
MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All EOS1 Products
Required fields are marked with *
My Review for All EOS1 Products
Required fields are marked with *
0
Inquiry Basket