Recombinant Full Length Saccharomyces Cerevisiae Monopolar Spindle Protein 2(Mps2) Protein, His-Tagged
Cat.No. : | RFL31257SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Monopolar spindle protein 2(MPS2) Protein (E7KCH6) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MSNGAFDAIFEYAWGQIDKPISGDFIYGKDLPKLIEIIENIFQKAQKSGSYELRLPLFSE INKDLFRTFSNTKTFFKIHKEEFDDIFFNLVNHPLREILENAFIGVDSIPSDFIVSMNLN SPSKFLVENKSKNTEGAGISTPRKKLTESPIKLLSRNNIGKALEVQVEELKRELTAKQSL LQENERQVSELKIRLETYQEKYASIQQRFSDLQKARQVEDNQNSSRTSDPGSPLVTGIDQ KAILEEFRRRLQRQTDTISFLKDQIRRERGLNCSNDKVSHSKRKHATTDGDGTFKNFISA VPSNIWVKATIRIIVCFALLAGVLPYIRKYVYAHDTPSQNSRLQLSWWENSGILSKIVWF FEDQTDLETEYRSNANVDDAYSRVFGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPS2 |
Synonyms | MPS2; MMC1; AWRI796_1721; Monopolar spindle protein 2 |
UniProt ID | E7KCH6 |
◆ Recombinant Proteins | ||
Ovca2-4630M | Recombinant Mouse Ovca2 Protein, Myc/DDK-tagged | +Inquiry |
SYNCRIP-5522R | Recombinant Rat SYNCRIP Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFRSF17-121HAF488 | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
RFL18547GF | Recombinant Full Length Chicken L-Dopachrome Tautomerase(Dct) Protein, His-Tagged | +Inquiry |
CARNS1-2519H | Recombinant Human CARNS1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
ACTC1-5294H | Native Human Actin, Alpha, Cardiac Muscle 1 | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC37-648HCL | Recombinant Human CDC37 cell lysate | +Inquiry |
ERAP2-2777HCL | Recombinant Human ERAP2 cell lysate | +Inquiry |
EFNB2-2405MCL | Recombinant Mouse EFNB2 cell lysate | +Inquiry |
NEO1-3874HCL | Recombinant Human NEO1 293 Cell Lysate | +Inquiry |
UNC5A-499HCL | Recombinant Human UNC5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MPS2 Products
Required fields are marked with *
My Review for All MPS2 Products
Required fields are marked with *
0
Inquiry Basket