Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Inner Membrane I-Aaa Protease Complex Subunit Mgr1(Mgr1) Protein, His-Tagged
Cat.No. : | RFL4336SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial inner membrane i-AAA protease complex subunit MGR1(MGR1) Protein (A6ZTE8) (1-416aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-416) |
Form : | Lyophilized powder |
AA Sequence : | MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTL ITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFP TLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPW CDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEA QNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSS TGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKRSSTTLSRGVILPHDTKGPQDIDL DTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MGR1 |
Synonyms | MGR1; SCY_0541; Mitochondrial inner membrane i-AAA protease complex subunit MGR1; Mitochondrial genome-required protein 1 |
UniProt ID | A6ZTE8 |
◆ Native Proteins | ||
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
MMP9-41H | Native Human MMP-9/TIMP-1 Complex | +Inquiry |
CTSD-1648H | Active Native Human Cathepsin D | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTRC-1720HCL | Recombinant Human CTRC cell lysate | +Inquiry |
TIMP1-2376MCL | Recombinant Mouse TIMP1 cell lysate | +Inquiry |
SLC22A24-1100HCL | Recombinant Human SLC22A24 cell lysate | +Inquiry |
MRAP2-4214HCL | Recombinant Human MRAP2 293 Cell Lysate | +Inquiry |
GOLGA7B-5833HCL | Recombinant Human GOLGA7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MGR1 Products
Required fields are marked with *
My Review for All MGR1 Products
Required fields are marked with *
0
Inquiry Basket