Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Carrier Protein Rim2(Rim2) Protein, His-Tagged
Cat.No. : | RFL10243SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial carrier protein RIM2(RIM2) Protein (P38127) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MPKKSIEEWEEDAIESVPYLASDEKGSNYKEATQIPLNLKQSEIENHPTVKPWVHFVAGG IGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETL GIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLM AAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLS ASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKF VASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVP NSIIMFGTWEIVIRLLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM2 |
Synonyms | RIM2; YBR192W; YBR1402; Mitochondrial carrier protein RIM2 |
UniProt ID | P38127 |
◆ Recombinant Proteins | ||
FGF7-5416H | Recombinant Human Fibroblast Growth Factor 7 | +Inquiry |
LDB3B-10231Z | Recombinant Zebrafish LDB3B | +Inquiry |
TBEVgp1-63E | Recombinant TBEV TBEVgp1 protein | +Inquiry |
IL35-1039H | Recombinant Human IL12A & IL27B Heterotrimer Protein (Met1-Ser219 & Met1-Lys229), His-Flag-tagged | +Inquiry |
TMEM60-4651R | Recombinant Rhesus Macaque TMEM60 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
KLHL36-210HCL | Recombinant Human KLHL36 cell lysate | +Inquiry |
TRNT1-749HCL | Recombinant Human TRNT1 293 Cell Lysate | +Inquiry |
SEPHS2-584HCL | Recombinant Human SEPHS2 lysate | +Inquiry |
SLC29A2-1742HCL | Recombinant Human SLC29A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RIM2 Products
Required fields are marked with *
My Review for All RIM2 Products
Required fields are marked with *
0
Inquiry Basket