Recombinant Full Length Saccharomyces Cerevisiae Mitochondrial Carrier Protein Mtm1(Mtm1) Protein, His-Tagged
Cat.No. : | RFL12323SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Mitochondrial carrier protein MTM1(MTM1) Protein (P53320) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MSDRNTSNSLTLKERMLSAGAGSVLTSLILTPMDVVRIRLQQQQMIPDCSCDGAAEVPNA VSSGSKMKTFTNVGGQNLNNAKIFWESACFQELHCKNSSLKFNGTLEAFTKIASVEGITS LWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLNPLFCGAIARVFAATSIAPLE LVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIY WSSYELCKERLWLDSTRFASKDANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISM MNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKVF GNKLHQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTM1 |
Synonyms | MTM1; YGR257C; G9175; Mitochondrial carrier protein MTM1; Manganese trafficking factor for mitochondrial SOD2 |
UniProt ID | P53320 |
◆ Recombinant Proteins | ||
RFL18395EF | Recombinant Full Length Equine Herpesvirus 1 Envelope Glycoprotein D(Gd) Protein, His-Tagged | +Inquiry |
ATP1B1-1131HF | Recombinant Full Length Human ATP1B1 Protein, GST-tagged | +Inquiry |
YOEA-0252B | Recombinant Bacillus subtilis YOEA protein, His-tagged | +Inquiry |
LALBA-4407H | Recombinant Human LALBA Protein (Lys20-Leu142), C-His tagged | +Inquiry |
Anp32a-1697M | Recombinant Mouse Anp32a protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-1565S | Active Native Sheep Stimulating Hormone | +Inquiry |
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
C3c-11H | Native Human C3c Protein | +Inquiry |
Lectin-1748B | Active Native Bauhinia Purpurea Lectin Protein | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK3-4494HCL | Recombinant Human MAPK3 293 Cell Lysate | +Inquiry |
ZZZ3-9177HCL | Recombinant Human ZZZ3 293 Cell Lysate | +Inquiry |
Raji-408H | Human Raji Membrane Lysate | +Inquiry |
AMD1-8886HCL | Recombinant Human AMD1 293 Cell Lysate | +Inquiry |
ERBB2-001CCL | Recombinant Cynomolgus ERBB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTM1 Products
Required fields are marked with *
My Review for All MTM1 Products
Required fields are marked with *
0
Inquiry Basket