Recombinant Full Length Saccharomyces Cerevisiae Membrane Protein Ptm1(Ptm1) Protein, His-Tagged
Cat.No. : | RFL26110SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Membrane protein PTM1(PTM1) Protein (P32857) (27-523aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-523) |
Form : | Lyophilized powder |
AA Sequence : | NKEKISQKNYQVCAGMYSKEDWKGKIDPFISFNLKKISGLSDESDPGLVVAIYDFQDFEH LGVQLPDEEMYYICDDYAIDIGICEEENRDEFIVQDVVYDPYTSTNRSLANPIMTFSQNE VGLHDTRYPIKETGFYCVTAFRSSTSTKFNAVVNFRNAYGQLAGTEINKLPLYGLLAVAY VVAMALYSFAFWKHKHELLPLQKYLLAFFVFLTAETIFVWAYYDLKNEKGDTAGIKVYMV FLSILTAGKVTFSFFLLLIIALGYGIVYPKLNKTLMRRCQMYGALTYAICIGFLIQSYLT DMEAPSPLILITLIPMALALIIFYYMIIRSMTKTVIYLKEQRQIVKLNMYKKLLYIIYAS FLSVLAGSIVSSFIYVGMNTIDMIEKNWRSRFFVTDFWPTLVYFIVFVTIAFLWRPTDTS YMLAASQQLPTDPENVADFDLGDLQSFDDQDDASIITGERGIDEDDLNLNFTDDEEGHDN VNNHSQGHGPVSPSPTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PTM1 |
Synonyms | PTM1; YKL039W; YKL252; Membrane protein PTM1 |
UniProt ID | P32857 |
◆ Recombinant Proteins | ||
CDH18A-4572Z | Recombinant Zebrafish CDH18A | +Inquiry |
IL17F-144M | Recombinant Mouse IL17F Protein | +Inquiry |
CANX-2072D | Recombinant Dog Calnexin | +Inquiry |
RFL28193MF | Recombinant Full Length Mouse Glycine Receptor Subunit Alpha-4(Glra4) Protein, His-Tagged | +Inquiry |
RFL20199SF | Recombinant Full Length Sclerotinia Sclerotiorum Solute Carrier Family 25 Member 38 Homolog (Ss1G_14414) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
IgG-016M | Native Mouse Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
MPOA-233H | Native Human Myeloperoxidase Isoform A | +Inquiry |
HSV2-16 | Native Herpes Simplex Virus (HSV) Type 2 Antigen | +Inquiry |
Factor Ixa-62H | Native Human Factor Ixa | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
Liver-301H | Human Liver Membrane Tumor Lysate | +Inquiry |
VPS37B-387HCL | Recombinant Human VPS37B 293 Cell Lysate | +Inquiry |
SSX4-1444HCL | Recombinant Human SSX4 293 Cell Lysate | +Inquiry |
ZNF483-2035HCL | Recombinant Human ZNF483 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTM1 Products
Required fields are marked with *
My Review for All PTM1 Products
Required fields are marked with *
0
Inquiry Basket