Recombinant Full Length Saccharomyces Cerevisiae Lipase 3(Tgl3) Protein, His-Tagged
Cat.No. : | RFL18366SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Lipase 3(TGL3) Protein (P40308) (1-642aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-642) |
Form : | Lyophilized powder |
AA Sequence : | MKETAQEYKVSAVIPTLLKNWILRVVYATLDHIPPFVWEILHVITDIYFFWVQKLINYVR PHSRVIYYNAIKKLDECDTYQMWCQQASVVDEITGANLWRRNFFSRRYDFNSVIEQYSIL ENMLREEKYDVVKEKFSTTGPCMLRNFAGIGDKKLFTKSLMGTKLLIEQYLTRILEGLDI LNNQTLTPTSFFQRCKLSLGTTALILQGGSLFGLFHLGVIRGLLLQDLMPNIISGSSMGA CVASLFGCLSNEQLKQLLTDDNLLNIIKNDVDLLKSCGYGNLEQHLNLGTLIQNLIHHGY SQDVYLFIRFVMKYIVKEKTFEEVYQITGKVFNIVIHPTDKSCPNLLNYVTTPNVLIKSA IECSLGSGVISEDTSLLCKNLENEIEPFLNINKNKQVKFLTPENANNPSITESPYTRLTE LFNVNNFIVSLARPYLAPLVVNDLKHEIKTSKYYYYKHYPNMPPINANTVRKTQRSSSQS PIKAGTVEDLEPEPLMSPVPPSSAVNDSAEYIIPELGIPQLNFTEMEPLAFKFKYHLERK LKNIATMEFRHRMEVLDNLGLLCSLIKRLIIDEKTPRSATEIAVVPRMKSLSLTRIIEGQ LNNIPYWIKSGERSTWPALALIKTRCAVEFKLDDIIRARRSR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TGL3 |
Synonyms | TGL3; YMR313C; YM9924.05C; Triacylglycerol lipase 3; Lipase 3 |
UniProt ID | P40308 |
◆ Recombinant Proteins | ||
KLRB1-4359H | Recombinant Human KLRB1 Protein (Lys68-Ser225), N-Fc tagged | +Inquiry |
RFL10796CF | Recombinant Full Length Chlamydia Muridarum Uncharacterized Protein Tc_0273(Tc_0273) Protein, His-Tagged | +Inquiry |
GHRHR-3303C | Recombinant Chicken GHRHR | +Inquiry |
CENPJ-3321HF | Recombinant Full Length Human CENPJ Protein, GST-tagged | +Inquiry |
UGDH-1953C | Recombinant Chicken UGDH | +Inquiry |
◆ Native Proteins | ||
CELA1-52P | Active Native Porcine pancreatic elastase | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
Ferritin-20M | Native Mouse Ferritin protein | +Inquiry |
Lectin-1800L | Active Native Lycopersicon Esculentum Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC9-7742HCL | Recombinant Human CCDC9 293 Cell Lysate | +Inquiry |
C1orf43-97HCL | Recombinant Human C1orf43 lysate | +Inquiry |
HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
ALMS1P-4700HCL | Recombinant Human LOC200420 293 Cell Lysate | +Inquiry |
SARS-2061HCL | Recombinant Human SARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGL3 Products
Required fields are marked with *
My Review for All TGL3 Products
Required fields are marked with *
0
Inquiry Basket