Recombinant Full Length Chlamydia Muridarum Uncharacterized Protein Tc_0273(Tc_0273) Protein, His-Tagged
Cat.No. : | RFL10796CF |
Product Overview : | Recombinant Full Length Chlamydia muridarum Uncharacterized protein TC_0273(TC_0273) Protein (Q9PL35) (1-367aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Chlamydia muridarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-367) |
Form : | Lyophilized powder |
AA Sequence : | MVKIMAPITPTTSPQVKGLLSRFLTAPDRHPKLRYVYDISLIAISILCIVSIILWTQGSG LALFAIAPALAIGALGVTLLVSDLAESPKSKEVADTVAAVSLPFILTGTAAGLMFSAIAV GGGAVILANPLFLMGSMTLGFALMSLHKVTYQYLSNRSQWQKQNKIKQIESAAWENKLPK ESKESSLQTSVRYSSLARKDKTRRNKPGMPNKGSQVPASIANTERSLRSEEVLHSQSLLR QKELFPNTSNIKKELPNTKSILHTPLNRRSPSGSDSDDVYYTPRAGLSSAETSALGDISG ISSSSTSSKTSTPKAKRRVVRSSRSERNARHHRNKEDHRQNQEESSDDEDSSPLPSPRRK KYRSRPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TC_0273 |
Synonyms | TC_0273; Uncharacterized protein TC_0273 |
UniProt ID | Q9PL35 |
◆ Recombinant Proteins | ||
XCL2-001H | Active Recombinant Human XCL2, MIgG2a Fc-tagged | +Inquiry |
SIGF-0080B | Recombinant Bacillus subtilis SIGF protein, His-tagged | +Inquiry |
Cxcl2-38M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 2 | +Inquiry |
PENK-6634M | Recombinant Mouse PENK Protein, His (Fc)-Avi-tagged | +Inquiry |
FSTL1-2065H | Recombinant Human FSTL1 protein(176-285aa), His-GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
Thrombin-21H | Active Native Cattle Thrombin | +Inquiry |
CK-5379P | Native Porcine Creatine-Phospho-Kinase | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
GG-186G | Native Goat Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPN1-7865HCL | Recombinant Human CAPN1 293 Cell Lysate | +Inquiry |
MAD2L1-4570HCL | Recombinant Human MAD2L1 293 Cell Lysate | +Inquiry |
DUSP23-6776HCL | Recombinant Human DUSP23 293 Cell Lysate | +Inquiry |
ZNF843-757HCL | Recombinant Human ZNF843 lysate | +Inquiry |
CRTAM-2216HCL | Recombinant Human CRTAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TC_0273 Products
Required fields are marked with *
My Review for All TC_0273 Products
Required fields are marked with *
0
Inquiry Basket