Recombinant Full Length Saccharomyces Cerevisiae Letm1 Domain-Containing Protein Ylh47, Mitochondrial(Ylh47) Protein, His-Tagged
Cat.No. : | RFL16416SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae LETM1 domain-containing protein YLH47, mitochondrial(YLH47) Protein (Q06493) (46-454aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (46-454) |
Form : | Lyophilized powder |
AA Sequence : | NSSVPESSKKELKTTDGNQESASKVSPVKEKEKVPFKVKMQKALRHYWDGSKLLGLEIKI SSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLFPNLLP STYESSKKRENKLENLRNTRKLMSEIIKNNKSHFKPNNISEEQKALFNRFYTHVRATGVP ESRQQLIEVARLFTDDTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDD LSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVLYSNLRLWLNMRLKDKIPSTLLIMAT AYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKEDEASAKQKLKQLREQEEIMKE EEQQEENAIVSVKDELSLDDQDKNIDAAAPDVKPHDTKPIGEAAAIKEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | YLH47 |
Synonyms | YLH47; MRS7; YPR125W; LETM1 domain-containing protein YLH47, mitochondrial; LETM1 homolog |
UniProt ID | Q06493 |
◆ Recombinant Proteins | ||
LSM2-4612H | Recombinant Human LSM2 Protein, His-tagged | +Inquiry |
IL17B-0191H | Recombinant Human IL17B protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
HSDL2-694H | Recombinant Human HSDL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TAF7-8503H | Recombinant Human TAF7, His and MBP-tagged | +Inquiry |
Ldlr-645M | Recombinant Mouse Ldlr protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MBP-99S | Native Swine MBP | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRK-5391HCL | Recombinant Human HRK 293 Cell Lysate | +Inquiry |
MRPL35-4176HCL | Recombinant Human MRPL35 293 Cell Lysate | +Inquiry |
BCMO1-8474HCL | Recombinant Human BCMO1 293 Cell Lysate | +Inquiry |
IRF8-5159HCL | Recombinant Human IRF8 293 Cell Lysate | +Inquiry |
CTSC-3024HCL | Recombinant Human CTSC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All YLH47 Products
Required fields are marked with *
My Review for All YLH47 Products
Required fields are marked with *
0
Inquiry Basket