Recombinant Human LSM2 Protein, His-tagged

• Cat.No.: LSM2-4612H
• Product Overview: Human LSM2 (NP_067000, 1 a.a. - 95 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
• Form: Liquid
• Molecular Mass: 13.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (5 mM DTT, 40% glycerol)

Gene Information

• Gene Name: LSM2 LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated [ Homo sapiens (human) ]
• Official Symbol: LSM2
• Synonyms: LSM2; LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated; G7B; snRNP; C6orf28; YBL026W; U6 snRNA-associated Sm-like protein LSm2; LSM2 U6 small nuclear RNA and mRNA degradation associated; LSM2 homolog, U6 small nuclear RNA associated; protein G7b; small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=57819
• mRNA Refseq: NM_021177
• Protein Refseq: NP_067000
• MIM: 607282
• UniProt ID: Q9Y333