Recombinant Full Length Saccharomyces Cerevisiae Gpi Transamidase Component Gaa1(Gaa1) Protein, His-Tagged
Cat.No. : | RFL5169SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae GPI transamidase component GAA1(GAA1) Protein (P39012) (1-614aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-614) |
Form : | Lyophilized powder |
AA Sequence : | MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLL ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF ESKSVVVRSKEKQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GAA1 |
Synonyms | GAA1; END2; YLR088W; L9449.4; GPI transamidase component GAA1 |
UniProt ID | P39012 |
◆ Recombinant Proteins | ||
UNC13D-6103R | Recombinant Rat UNC13D Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLC-192HF | Recombinant Full Length Human GCLC Protein | +Inquiry |
OPTN-512C | Recombinant Cynomolgus Monkey OPTN Protein, His (Fc)-Avi-tagged | +Inquiry |
HEXB-1063H | Recombinant Human HEXB Protein, His (Fc)-Avi-tagged | +Inquiry |
RNF167-3752R | Recombinant Rhesus Macaque RNF167 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD2BP2-175HCL | Recombinant Human CD2BP2 lysate | +Inquiry |
F2RL1-6484HCL | Recombinant Human F2RL1 293 Cell Lysate | +Inquiry |
AGT-2575HCL | Recombinant Human AGT cell lysate | +Inquiry |
CNTFR-598RCL | Recombinant Rat CNTFR cell lysate | +Inquiry |
CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GAA1 Products
Required fields are marked with *
My Review for All GAA1 Products
Required fields are marked with *
0
Inquiry Basket