Recombinant Full Length Saccharomyces Cerevisiae Genetic Interactor Of Prohibitin 7, Mitochondrial(Gep7) Protein, His-Tagged
Cat.No. : | RFL36892SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Genetic interactor of prohibitin 7, mitochondrial(GEP7) Protein (C7GRJ3) (25-287aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (25-287) |
Form : | Lyophilized powder |
AA Sequence : | AVAGNLLVKRFYQPKLERIPPASLLLKQKIRLAQNGSTTSTENPISFSQTMSEIFSVLQP SAPDLDEDKTSGLKRDHLLTERLNNGELGVIMNKFFNPSSTHNNQLIDTNILLQNFPKLS GNDLDLLDFAINEKMRGNWNDLKQDFIQLWYYKSFGFLGPRTQFVLTNSSPSLRSQFLKL PFTEYNWFLLQNNKNANILPADVQNVVKVFHLDDKRFTWKSIDPFSKAIISFVVFVSIYV WLDESAKQKTKDLPAQKSTVISE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GEP7 |
Synonyms | GEP7; C1Q_02976; Genetic interactor of prohibitin 7, mitochondrial |
UniProt ID | C7GRJ3 |
◆ Recombinant Proteins | ||
SNX1-800H | Recombinant Human SNX1 protein, His-tagged | +Inquiry |
ALAS2-27277TH | Recombinant Human ALAS2, His-tagged | +Inquiry |
ACVR1-01H | Recombinant Human Activin A Receptor, Type I | +Inquiry |
RFL22404GF | Recombinant Full Length Guizotia Abyssinica Atp Synthase Subunit C, Chloroplastic(Atph) Protein, His-Tagged | +Inquiry |
GBGT1-4774H | Recombinant Human GBGT1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
Lectin-1759C | Active Native Canavalia ensiformis Concanavalin A Protein, Fluorescein Labeled | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
PLG-27925TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG1-2886MCL | Recombinant Mouse IgG1 cell lysate | +Inquiry |
Pancreas-772C | Chicken Pancreas Membrane Lysate, Total Protein | +Inquiry |
FHL1-6225HCL | Recombinant Human FHL1 293 Cell Lysate | +Inquiry |
MOAP1-4267HCL | Recombinant Human MOAP1 293 Cell Lysate | +Inquiry |
SUPT3H-1339HCL | Recombinant Human SUPT3H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GEP7 Products
Required fields are marked with *
My Review for All GEP7 Products
Required fields are marked with *
0
Inquiry Basket