Recombinant Human SNX1 protein, His-tagged

• Cat.No.: SNX1-800H
• Product Overview: Recombinant Human SNX1 protein(NP_001229862)(81-287 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: 81-287 aa
• AA Sequence: QDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SNX1 sorting nexin 1 [ Homo sapiens ]
• Official Symbol: SNX1
• Synonyms: SNX1; sorting nexin 1; sorting nexin-1; HsT17379; MGC8664; SNX1A; Vps5; sorting nexin 1A; VPS5
• Gene ID: 6642
• mRNA Refseq: NM_001242933
• Protein Refseq: NP_001229862
• MIM: 601272
• UniProt ID: Q13596